Loading...
Statistics

Riordan Tours of St. Louis, MO Attractions
www.stlhauntedhistory.com/
Riordan Tours of St. Louis, MO Attractions
Advertisement

Stlhauntedhistory.com

Stlhauntedhistory.com is hosted in United States / Provo . Stlhauntedhistory.com uses HTTPS protocol. Number of used technologies: 10. First technologies: Carousel, CSS, Flexslider, Number of used javascripts: 10. First javascripts: Jquery.js, Jquery-migrate.min.js, Cro_nav.js, Number of used analytics tools: 1. First analytics tools: Google Analytics, Number of used plugins, modules: 1. Its server type is: nginx/1.8.1. Its CMS is: Wordpress.

Technologies in use by Stlhauntedhistory.com

Technology

Number of occurences: 10
  • Carousel
  • CSS
  • Flexslider
  • Google Font API
  • Html
  • Javascript
  • jQuery
  • MediaElement
  • Php
  • Pingback

Advertisement

Javascripts

Number of occurences: 10
  • jquery.js
  • jquery-migrate.min.js
  • cro_nav.js
  • external-tracking.min.js
  • www.js
  • mediaelement-and-player.min.js
  • foundation.min.js
  • app.js
  • wp-embed.min.js

Content Management System

Number of occurences: 1
  • Wordpress

Analytics

Number of occurences: 1
  • Google Analytics

Server Type

  • nginx/1.8.1

Used plugins, modules

Number of plugins and modules: 1
  • google analyticator

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Stlhauntedhistory.com

SSL certificate

    • name: /OU=Domain Control Validated/OU=Hosted by BlueHost.Com, INC/OU=PositiveSSL Wildcard/CN=*.bluehost.com
    • subject:
      • OU:
        • 0: Domain Control Validated
        • 1: Hosted by BlueHost.Com, INC
        • 2: PositiveSSL Wildcard
      • CN: *.bluehost.com
    • hash: b00471fb
    • issuer:
      • C: GB
      • ST: Greater Manchester
      • L: Salford
      • O: COMODO CA Limited
      • CN: COMODO RSA Domain Validation Secure Server CA
    • version: 2
    • serialNumber: 275919344465328667035358918366332841359
    • validFrom: 150313000000Z
    • validTo: 180312235959Z
    • validFrom_time_t: 1426204800
    • validTo_time_t: 1520899199
    • extensions:
      • authorityKeyIdentifier: keyid:90:AF:6A:3A:94:5A:0B:D8:90:EA:12:56:73:DF:43:B4:3A:28:DA:E7
      • subjectKeyIdentifier: 29:B6:2F:A5:A8:41:C7:45:BE:86:84:10:E9:26:A7:94:67:64:BC:73
      • keyUsage: Digital Signature, Key Encipherment
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • certificatePolicies: Policy: 1.3.6.1.4.1.6449.1.2.2.7 CPS: https://secure.comodo.com/CPS Policy: 2.23.140.1.2.1
      • crlDistributionPoints: Full Name: URI:http://crl.comodoca.com/COMODORSADomainValidationSecureServerCA.crl
      • authorityInfoAccess: CA Issuers - URI:http://crt.comodoca.com/COMODORSADomainValidationSecureServerCA.crt OCSP - URI:http://ocsp.comodoca.com
      • subjectAltName: DNS:*.bluehost.com, DNS:bluehost.com

Meta - Stlhauntedhistory.com

Number of occurences: 5
  • Name:
    Content: text/html; charset=UTF-8
  • Name: viewport
    Content: width=device-width
  • Name: description
    Content: Riordan Tours of St. Louis, MO Attractions
  • Name: keywords
    Content: Riordan Tours of St. Louis, MO Attractions
  • Name: generator
    Content: WordPress 4.4.2

Server / Hosting

  • IP: 69.89.31.183
  • Latitude: 40.22
  • Longitude: -111.61
  • Country: United States
  • City: Provo

Rname

  • ns1.bluehost.com
  • ns2.bluehost.com
  • mail.stlhauntedhistory.com

Target

  • root.box383.bluehost.com

HTTP Header Response

HTTP/1.1 301 Moved Permanently Server: nginx/1.8.1 Date: Thu, 14 Apr 2016 03:04:50 GMT Content-Type: text/html; charset=UTF-8 Connection: keep-alive Location: http://www.stlhauntedhistory.com/ Vary: Accept-Encoding HTTP/1.1 200 OK Server: nginx/1.8.1 Date: Thu, 14 Apr 2016 03:04:51 GMT Content-Type: text/html; charset=UTF-8 Connection: keep-alive Link: ; rel="https://api.w.org/" Vary: Accept-Encoding

DNS

host: stlhauntedhistory.com
  1. class: IN
  2. ttl: 14399
  3. type: A
  4. ip: 69.89.31.183
host: stlhauntedhistory.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns1.bluehost.com
host: stlhauntedhistory.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns2.bluehost.com
host: stlhauntedhistory.com
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns1.bluehost.com
  5. rname: root.box383.bluehost.com
  6. serial: 2014080802
  7. refresh: 86400
  8. retry: 7200
  9. expire: 3600000
  10. minimum-ttl: 300
host: stlhauntedhistory.com
  1. class: IN
  2. ttl: 14400
  3. type: MX
  4. pri: 0
  5. target: mail.stlhauntedhistory.com
host: stlhauntedhistory.com
  1. class: IN
  2. ttl: 14400
  3. type: TXT
  4. txt: v=spf1 a mx ptr include:bluehost.com ?all
  5. entries: Array

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.tlhauntedhistory.com, www.setlhauntedhistory.com, www.etlhauntedhistory.com, www.swtlhauntedhistory.com, www.wtlhauntedhistory.com, www.sdtlhauntedhistory.com, www.dtlhauntedhistory.com, www.sxtlhauntedhistory.com, www.xtlhauntedhistory.com, www.sftlhauntedhistory.com, www.ftlhauntedhistory.com, www.sgtlhauntedhistory.com, www.gtlhauntedhistory.com, www.sttlhauntedhistory.com, www.ttlhauntedhistory.com, www.slhauntedhistory.com, www.stqlhauntedhistory.com, www.sqlhauntedhistory.com, www.stalhauntedhistory.com, www.salhauntedhistory.com, www.st lhauntedhistory.com, www.s lhauntedhistory.com, www.stwlhauntedhistory.com, www.swlhauntedhistory.com, www.stelhauntedhistory.com, www.selhauntedhistory.com, www.stzlhauntedhistory.com, www.szlhauntedhistory.com, www.stxlhauntedhistory.com, www.sxlhauntedhistory.com, www.stclhauntedhistory.com, www.sclhauntedhistory.com, www.sthauntedhistory.com, www.stluhauntedhistory.com, www.stuhauntedhistory.com, www.stl8hauntedhistory.com, www.st8hauntedhistory.com, www.stl9hauntedhistory.com, www.st9hauntedhistory.com, www.stljhauntedhistory.com, www.stjhauntedhistory.com, www.stl0hauntedhistory.com, www.st0hauntedhistory.com, www.stlmhauntedhistory.com, www.stmhauntedhistory.com, www.stlphauntedhistory.com, www.stphauntedhistory.com, www.stlohauntedhistory.com, www.stohauntedhistory.com, www.stlauntedhistory.com, www.stlheauntedhistory.com, www.stleauntedhistory.com, www.stlhdauntedhistory.com, www.stldauntedhistory.com, www.stlhcauntedhistory.com, www.stlcauntedhistory.com, www.stlhuauntedhistory.com, www.stluauntedhistory.com, www.stlhjauntedhistory.com, www.stljauntedhistory.com, www.stlhauntedhistory.com, www.stlauntedhistory.com, www.stlhbauntedhistory.com, www.stlbauntedhistory.com, www.stlhgauntedhistory.com, www.stlgauntedhistory.com, www.stlhuntedhistory.com, www.stlhaountedhistory.com, www.stlhountedhistory.com, www.stlhapuntedhistory.com, www.stlhpuntedhistory.com, www.stlha9untedhistory.com, www.stlh9untedhistory.com, www.stlhauntedhistory.com, www.stlhuntedhistory.com, www.stlhaiuntedhistory.com, www.stlhiuntedhistory.com, www.stlhauuntedhistory.com, www.stlhuuntedhistory.com, www.stlhantedhistory.com, www.stlhauwntedhistory.com, www.stlhawntedhistory.com, www.stlhauentedhistory.com, www.stlhaentedhistory.com, www.stlhausntedhistory.com, www.stlhasntedhistory.com, www.stlhauantedhistory.com, www.stlhaantedhistory.com, www.stlhautedhistory.com, www.stlhaunntedhistory.com, www.stlhauntedhistory.com, www.stlhaunhtedhistory.com, www.stlhauhtedhistory.com, www.stlhaunjtedhistory.com, www.stlhaujtedhistory.com, www.stlhaunktedhistory.com, www.stlhauktedhistory.com, www.stlhaunltedhistory.com, www.stlhaultedhistory.com, www.stlhaun tedhistory.com, www.stlhau tedhistory.com, www.stlhaunedhistory.com, www.stlhauntqedhistory.com, www.stlhaunqedhistory.com, www.stlhauntaedhistory.com, www.stlhaunaedhistory.com, www.stlhaunt edhistory.com, www.stlhaun edhistory.com, www.stlhauntwedhistory.com, www.stlhaunwedhistory.com, www.stlhaunteedhistory.com, www.stlhauneedhistory.com, www.stlhauntzedhistory.com, www.stlhaunzedhistory.com, www.stlhauntxedhistory.com, www.stlhaunxedhistory.com, www.stlhauntcedhistory.com, www.stlhauncedhistory.com, www.stlhauntdhistory.com, www.stlhauntexdhistory.com, www.stlhauntxdhistory.com, www.stlhauntesdhistory.com, www.stlhauntsdhistory.com, www.stlhauntewdhistory.com, www.stlhauntwdhistory.com, www.stlhaunterdhistory.com, www.stlhauntrdhistory.com, www.stlhauntefdhistory.com, www.stlhauntfdhistory.com, www.stlhauntevdhistory.com, www.stlhauntvdhistory.com, www.stlhauntecdhistory.com, www.stlhauntcdhistory.com, www.stlhaunteqdhistory.com, www.stlhauntqdhistory.com, www.stlhaunteadhistory.com, www.stlhauntadhistory.com, www.stlhaunteydhistory.com, www.stlhauntydhistory.com, www.stlhauntehistory.com, www.stlhauntedthistory.com, www.stlhauntethistory.com, www.stlhauntedghistory.com, www.stlhaunteghistory.com, www.stlhauntedbhistory.com, www.stlhauntebhistory.com, www.stlhauntedxhistory.com, www.stlhauntexhistory.com, www.stlhauntedshistory.com, www.stlhaunteshistory.com, www.stlhauntedfhistory.com, www.stlhauntefhistory.com, www.stlhauntedvhistory.com, www.stlhauntevhistory.com, www.stlhauntedyhistory.com, www.stlhaunteyhistory.com, www.stlhauntedzhistory.com, www.stlhauntezhistory.com, www.stlhauntedahistory.com, www.stlhaunteahistory.com, www.stlhauntedehistory.com, www.stlhaunteehistory.com, www.stlhauntedrhistory.com, www.stlhaunterhistory.com,

Other Reviews

  1. Home
    Scottsdale (United States) - 72.167.191.69
    Server software: DPS/1.0.6
    Technology: BootstrapCDN, Maxcdn, CSS, Font Awesome, Html, Html5, Javascript
    Number of Javascript: 1
    Number of meta tags: 2
  2. Botel MATYLDA - Botel Matylda
    Botel MATYLDA
    Prague (Czech Republic) - 94.142.233.164
    Server software: Apache/2.2
    Technology: CSS, Html, Javascript, Php, Swf Object
    Number of Javascript: 3
    Number of meta tags: 3
  3. fukuoka school, special education school
    The mission of our organization is to educate and train the special children in such a way that their dependence on their parents be reduced and they become....
    Houston (United States) - 192.185.122.147
    G Analytics ID: UA-73672830-1
    Server software: nginx/1.10.1
    Technology: CSS, Google Font API, Html, Html5, Javascript, jQuery, Php, Pingback, Shortcodes, Google Analytics, Wordpress
    Number of Javascript: 7
    Number of meta tags: 5
  4. superawesomemegagiganticprettysweetfriendzine.com
    Switzerland - 141.8.224.93
    Server software: Apache
    Technology: Html
  5. Circus in Education | School Workshops & Performances
    Circus in Education delivers physical demonstration and emotional skills into classrooms through school workshops & performances throughout Australia.
    Sydney (Australia) - 52.64.177.7
    Server software: Apache
    Technology: Carousel, CSS, Google Font API, Html, Html5, Iframe, Javascript, Php, Pingback, Shortcodes, Google Analytics, Wordpress
    Number of Javascript: 6
    Number of meta tags: 9
  6. srmg.info
    Lansing (United States) - 69.16.192.64
    Server software: nginx/1.10.1
    Technology: CSS, Html, Javascript, Php, Google Analytics
    Number of meta tags: 1
  7. ideenfix.de
    Germany - 62.116.130.8
    Server software: Apache
    Technology: Html, Html5
  8. beachbudcaddy.net
    Scottsdale (United States) - 184.168.221.49
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  9. Tere tulemast ! - Arvutiteenused ja kaugabi.
    Estonia - 212.47.208.172
    Server software: Apache/2
    Technology: BootstrapCDN, Maxcdn, CSS, Font Awesome, Google Font API, Html, Html5, Javascript, jQuery, jQuery Cookie, jQuery Cycle, Lightbox, Php, Pingback, Swf Object, Google Analytics, Wordpress, Facebook Box
    Number of Javascript: 27
    Number of meta tags: 3
  10. .: Green Energy Group :.
    Romania - 86.106.30.142
    Server software: LiteSpeed
    Technology: CSS, Html
    Number of meta tags: 1